Home / Products / proteins / RhoC, 1-190aa, Human, His tag, E.coli

RhoC, 1-190aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RhoC, also known as rho-related GTP-binding protein RhoC, is a small signaling G protein (more specifically a GTPase), and is a member of the Rac subfamily of the family Rho family of GTPases. It cycles between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. RhoC promotes reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03735
Size 50 µg
Host E.coli
Accession
Molecular Weight 23.8 (210aa) confirmed by MALDI-TOF (Real molecular weight on SDS-PAGE will be shift up)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names Rho-related GTP-binding protein RhoC, ARH9, ARHC, H9, RHOH9
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap