Home / Products / proteins / RhoB, 1-193aa, Human, His tag, E.coli

RhoB, 1-193aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Rho-related GTP-binding protein RhoB, also known as RhoB, is a member of the Rho GTP-binding protein family. RhoB mediates apoptosis in neoplastically transformed cells after DNA damage. It plays a negative role in tumorigenesis as deletion causes tumor formation. Recombinant human RhoB protein, fused to His-tag at Nterminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03734
Size 50 µg
Host E.coli
Accession
Molecular Weight 23.9kDa (213aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCC
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT,20% glycerol, 0.2mM NaCl
Other Names Rho-related GTP-binding protein RhoB, ARH6, ARHB, MST081, MSTP081, RHOH6
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap