RGS5, 1-181aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RGS5, also known as regulator of G-protein signaling 5, binds directly to activated G alpha subunits and act as GTPase-activating proteins(GAPs) to attenuate and/or modulate hormone and neurotransmitter receptor-initiated signaling by both G alpha-GTP and G beta gamma. Vascular endothelial cells express the RGS protein RGS5, where it correlates with capillary morphogenesis, thus rendering it a candidate gene involved in capillary growth, angiogenesis, and also potentially the pathophysiology of stroke.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03731
Size 100ug
Host E.coli
Accession
Molecular Weight 23.5 kDa (205aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names Regulator of G-protein signaling 5, MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap