Home / Products / proteins / RGS19, 1-217aa, Human, His tag, E.coli

RGS19, 1-217aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RGS19, also known as Regulator of G-protein signaling 19, belongs to RGS (regulator of G protein signaling) family and negatively regulates G protein coupled receptor signaling. This protein specifically interacts with heterotrimeric GTP-binding protein G alpha i3 (GAI3). Recombinant human RGS19 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03727
Size 100 µg
Host E.coli
Accession
Molecular Weight 26.7 kDa(237aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate Buffered Saline (pH7.4) containing 10% Glycerol
Other Names Regulator of G-protein signaling 19, GAIP, GNAI3IP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap