RGS16, 1-202aa, Human, His-tag, E.coli

Categories: [Proteins / Peptides]
RGS16, also known as regulator of G-protein signaling 16, belongs to 'regulator of G protein signaling' family and negatively regulates G protein coupled receptor signalling. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP bound form. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03725
Size 50 µg
Host E.coli
Accession
Molecular Weight 24.9 kDa (222aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate Buffered Saline (pH7.4) containing 20% glycerol 0.1M NaCl
Other Names Regulator of G-protein signaling 16, A28-RGS14, A28-RGS14P, RGS-R
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap