REN, 24-406aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
REN, also known as renin, is a member of the peptidase A1 family. It is synthesized by the juxtaglomerular cells of the kidney in response to decreased blood pressure and sodium concentration. It is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. Recombinant human REN, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03711
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 43.3kDa (391aa), 40-57kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARLEHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Renin , REN, HNFJ2, Angiotensin forming enzyme, Angiotensin forming enzyme precursor, Angiotensinogenase, Angiotensinogenase precursor, FLJ10761, HNFJ2, REN, Ren1, RENI_HUMAN, Renin, Renin precursor renal.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap