REG4, 23-158aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
REG4 also known as Regenerating islet-derived protein 4. This protein is calcium-independent lectin displaying mannose-binding specificity and able to maintain carbohydrate recognition activity in an acidic environment. It may be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium. Recombinant human REG4, fused to T7-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03710
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.5 kDa (152aa)
AP_Mol_Weight
Tag N-6His
Sequences MASMTGGQQMGRGSHMDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid, In 20mM Tris-HCl (pH8.0) containing 10% glycerol
Other Names Regenerating islet-derived protein 4 isoform 1, GISP, RELP, REG-IV
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap