RBP7, 1-134aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RBP7, also known as CRBP4, belongs to a superfamily of small cytoplasmic proteins which interact with hydrophobic ligands. RBP7 is cytoplasmic protein that, like CRBP I and CRBP II, form β-barrel structures and participates in the intracellular transport of retinol. RBP7 is a recently identified cellular retinol carrier, expressed in the kidney, heart and transverse colon in humans. Recombinant human RBP7 protein, fused to His-tag at Nterminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03699
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.6 kDa (154aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl, 2mM DTT, 20% glycerol
Other Names Retinoid-binding protein 7, CRBP4, CRBPIV, MGC70641
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap