Home / Products / proteins / RBM8A, 1-174aa, Human, His tag, E.coli

RBM8A, 1-174aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RBM8A is a member of the EJC(The exon junction complex) that is involved in mRNA export, cytoplasmic localization and nonsense mediated mRNA decay. This protein has the ability to communicate to the cytoplasm the processing history of the mRNA, including the position of the removed introns. Although it shuttles to the cytoplasm, it is predominantly detected in the nucleus and is colocalized with oskar mRNA at the posterior pole of the cell.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03694
Size 50 µg
Host E.coli
Accession
Molecular Weight 20.9 kDa(182aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRRLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 0.1M NaCl,1mM DTT
Other Names RNA-binding protein 8A, BOV-1A; BOV-1B, BOV-1C, MDS014, RBM8, RBM8B, Y14, ZNRP, ZRNP1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap