RARRES2, 21-157aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
RARRES2, as known as retinoic acid receptor responder protein 2, is a distant member of the Cystatin superfamily. Members of this superfamily contain at least two intra-chain disulfide bonds and an alpha-helical structure over a distance of about 100 amino acids. This protein was found to stimulate chemotaxis of dendritic cells and macrophages to the site of inflammation. Also, it has been implicated in autocrine/paracrine signaling for adipocyte differentiation and also stimulation of lipolysis. Recombinant human RARRES2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03681
Size 20 µg
Host Baculovirus
Accession
Molecular Weight 16.9kDa (146aa), 18-28kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Retinoic acid receptor responder protein 2, RARRES2, HP10433, TIG2, Chemerin
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap