Home / Products / proteins / RARRES1, 43-294aa, Human, His tag, E.coli

RARRES1, 43-294aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Retinoic acid receptor responder protein 1 isoform 1, also known as RARRES1, belongs to the TIGs (Tazarotene-induced gene) family. TIGs act as tumor suppressor genes in human cancers and are highly expressed in skin, hair follicles and endothelial cells as well as in pancreas, spleen and intestine. TIGs are activated by tazarotene and have been implicated as growth regulators that mediate the growth suppressive effects of retinoids. Recombinant human RARRES1 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03679
Size 100 µg
Host E.coli
Accession
Molecular Weight 31.3kDa (275aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names Retinoic acid receptor responder protein 1 isoform 1, TIG1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap