RAPSN, 1-412aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
43 kDa receptor-associated protein of the synapse, also known as RAPSN, is expressed in the postsynaptic membrane of skeletal muscle. RAPSN is required for the clustering of nicotinic acetylcholine receptors (nAChR). It self-associates through at least two of its seven tetra-tricopeptide repeats (TPRs). RAPSN interacts with the large intracellular domain of the nAChR a subunit through the hydrophobic surface of the coiled-coil domain. This protein modifies trafficking of AChR within the cell. Overexpression inhibits agrin-induced AChR clustering pathway. Recombinant human RAPSN protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03678
Size 100 µg
Host E.coli
Accession
Molecular Weight 48.8 kDa (435aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMGQDQTKQQIEKGLQLYQSNQTEKALQVWMKVLEKGSDLVGRFRVLGCLVTAHSEMGRYKEMLKFAVVQIDTARGLEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSLFQKALESFEKALRYAHNNDDTMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNDYGKGWSLKYRAMSQYHMAVAYRLLGHLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVHVLLGVAKCWMARKVQDKALDAIEKAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRTHVVRFHECVEETELYCGLCGESIGERNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.4M Urea
Other Names 43 kDa receptor-associated protein of the synapse, 43kDa, Nraps, Raps, rapsyn
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap