RAP2B, 1-183aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Ras-related protein Rap-2b, also known as RAP2B, belongs to a family of RAS-related genes. Unlike normal ras proteins that have a nontransforming glutamine residue at aa 61, Rap2B has a threonine residue in that position. This change makes the intrinsic GTPase activity for Rap2B lower, thereby allowing it to exist in the activated state for a longer period of time than normal ras proteins. RAP2B is a platelet protein that is activated by thrombin and involved in platelet activation. RAP2B may be a novel candidate oncogene that plays important roles in carcinogenesis through activation of NF-kappaB pathway. Recombinant human RAP2B protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03677
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.9kDa (206aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 20% glycerol, 1mM DTT
Other Names Ras-related protein Rap-2b, RAP2B, member of RAS oncogene family
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap