Home / Products / proteins / Rantes, 24-91 aa, Human, Recombinant, E.coli

Rantes, 24-91 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Rantes, also known as CCL5, is the protein classified as a chemotactic cytokine or chemokine. This protein is a chemotactic for blood monocytes, memory T helper cells, eosinophils and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. Rantes also induces the proliferation and activation of certain natural-killer (NK) cells to form CHAK (CC-Chemokine-activated killer) cells.
List Price: $731
  • Buy 5 for $694.45 each and save 5%
  • Buy 21 for $657.9 each and save 10%
  • Buy 31 for $621.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03673
Size 100 µg
Host E.coli
Accession
Molecular Weight 7.9 kDa (69aa)
AP_Mol_Weight
Tag
Sequences MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 10 mM Sodium Citrate (pH 3.5) containing 10% Glycerol.
Other Names Small inducible cytokine A5, CCL5, D17S136E, SCYA5, SISd, TCP228.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap