Home / Products / proteins / RALB, 1-203aa, Human, His tag, E.coli

RALB, 1-203aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RALB, also called Ras-related protein Ral-B, belongs to subfamily of Ras-related GTPases. This protein is activated by a unique nucleotide exchange factor, Ral GDS, and deactivated by a distinct GTPaseactivating protein. It plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03665
Size 50 μg
Host E.coli
Accession
Molecular Weight 25.6 kDa (227aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERC
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.1M NaCl, 1mM DTT
Other Names Ras-related protein Ral-B
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap