Home / Products / proteins / RALA, 1-203aa, Human, His tag, E.coli

RALA, 1-203aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RALA (Ras-related protein Ral-A) belongs to the small GTPase superfamily, Ras family of proteins. RALA mediates a distinct downstream signaling pathway from Ras that facilitates cellular transformation. RALA is also thought to be involved in numerous signaling cascades, including regulation of the cytoskeleton, vesicle trafficking, and endocytosis.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03664
Size 100 μg
Host E.coli
Accession
Molecular Weight 25.8kDa (227aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERC
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 2mM DTT, 100mM NaCl, 0.1mM PMSF
Other Names Ras-related protein Ral-A, RAL
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap