Raet1e, 29-227aa, Mouse, His-tag, Baculovirus

Categories: [Proteins / Peptides]
Raet1e, also known as retinoic acid early-inducible protein 1-epsilon, is a member of a family of cell-surface proteins that function as ligands for mouse NKG2D. All Rae-1 family members bind to mouse NKG2D, an activating receptor expressed on NK cells and some T cell subsets, resulting in the activation of cytolytic activity and cytokine production by these effector cells. Recombinant mouse Raet1e, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03662
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 23.5kDa (207aa), 28-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences LDDAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLTQPLNDLCQELRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDEFLKQSKEKPRSTSRSPSITQLTSTSPLPPPSHSLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Retinoic acid early-inducible protein 1-epsilon, Raet1e
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap