Home / Products / proteins / RAC3, 1-189aa, Human, E.coli

RAC3, 1-189aa, Human, E.coli

Categories: [Proteins / Peptides]
RAC3 is a member of the Rac subfamily of the Rho small G proteins. This protein is a small (~21 kDa) monomeric GTP-binding protein, and is an important component of intracellular signalling pathway, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Recombinant human RAC3 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03657
Size 100 μg
Host E.coli
Accession
Molecular Weight 21kDa (189aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 2mM DTT, 200mM NaCl, 0.1mM PMSF, 1mM EDTA
Other Names ras-related C3 botulinum toxin substrate 3, p21-Rac3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap