RAC1 Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Rac1, belonging to the Rho small GTPase family, regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion. RecombinantRAC1 was expressed inE.coliand purified byusingconventional chromatographytechniques.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03653
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.4 kDa (192 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 1 mM DTT 2 mM EDTA
Other Names Ras-related C3 botulinum toxin substrate 1 isoform Rac1, MIG5, p21-Rac1, TC-25
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap