RABIF, 1-123aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RABIF, also known as guanine nucleotide exchange factor MSS4, is a guanine-nucleotide-releasing protein that may participate in vesicular transport. This protein stimulates GTP-GDP exchange in Sec4 and Rab and binds to a subset of genetically related Rab proteins. Recombinant human RABIF protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03651
Size 50 µg
Host E.coli
Accession
Molecular Weight 16.0 kDa (143aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names Guanine nucleotide exchange factor MSS4, MSS4, RASGFR3, RASGRF3, Rab-interacting factor
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap