RAB5B, 1-215aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Ras-related protein Rab-5B, also known as RAB5B, is a member of the Rab family of small (monomeric) G proteins. RAB5B is involved in endocytosis and recycling of cell surface molecules. It interacts with RIN2 and RIN3, which regulate its function, possibly by acting as GEFs. Knockdown of RAB5B abolished group I metabotropic glutamate receptor (mGluR)-mediated neuroprotection. Recombinant human RAB5B protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03645
Size 100 μg
Host E.coli
Accession
Molecular Weight 26.1 kDa (238aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT,20% glycerol, 0.2M NaCl
Other Names Ras-related protein Rab-5B
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap