RAB4A, 1-218aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RAB4A belongs to the small GTPase superfamily. RAB4A has been shown to interact with STX4, RAB11FIP1, RABEP1, CD2AP and KIF3B. Rab4 is also involved in the translocation of glucose transporter (Glu4) in adipocytes in response to insulin. Overexpression of Rab4 causes a redistribution of receptors on plasma membrane versus endocytic compartments.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03643
Size 100 µg
Host E.coli
Accession
Molecular Weight 26.5 kDa (238aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names Ras-related protein Rab-4A, HRES-1/RAB4, RAB4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap