Home / Products / proteins / RAB3D, 1-219aa, Human, His tag, E.coli

RAB3D, 1-219aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Ras-related protein Rab-3D, also known as GOV, is a member of the Ras superfamily of small Rab GTPases. Rab proteins play an important role for, either in endocytosis or in biosynthetic protein transport. Rab3D mRNA is predominantly expressed in white adipose tissue and, coincident with GLUT4, increases upon differentiation of 3T3-L1 broblasts into insulin-responsive adipocytes.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03641
Size 100 µg
Host E.coli
Accession
Molecular Weight 26.4 kDa (239aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 30% glycerol, 0.2M NaCl
Other Names Ras-related protein Rab-3D, GOV, RAB16
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap