RAB32, 1-225aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RAB32 belongs to the small GTPase superfamily. RAB32 modulates ER calcium handling and disrupts the specific enrichment of calnexin on the MAM (mitochondria-associated membrane), while not affecting the ER distribution of protein-disulfide isomerase and mitofusin-2. Also, RAB32 determines the targeting of PKA (cAMP-dependent protein kinase) to mitochondrial and ER membranes and through its overexpression or inactivation increases the phosphorylation of Bad and of Drp1.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03635
Size 100 µg
Host E.coli
Accession
Molecular Weight 27.6kDa (249aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 5mM DTT, 50% glycerol, 200mM NaCl, 2mM EDTA
Other Names Ras-related protein Rab-32.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap