Home / Products / proteins / RAB27A, 1-221aa, Human, His tag, E.coli

RAB27A, 1-221aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Ras-related protein Rab-27A, also known as RAB27A, belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Also, RAB27A regulates the cytotoxic granule exocytosis and affect T-lymphocyte and macrophage-activation. It is widely expressed with significant expression in pancreatic islets and pituitary tissue, and low expression in brain. Defects in RAB27A cause Griscelli syndrome type 2 (GS2).
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03630
Size 100 µg
Host E.coli
Accession
Molecular Weight 27 kDa (241aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 20% glycerol
Other Names Ras-related protein Rab-27A, GS2, RAM, RAB27
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap