Home / Products / proteins / RAB24, 1-203aa, Human, His tag, E.coli

RAB24, 1-203aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RAB24 belongs to the small GTPase superfamily. Members of the Rab GTPase family regulate intracellular protein trafficking, but the specific function of RAB24 remains unknown. RAB24 is distributed in the endoplasmic reticulum/cis-Golgi region and on late endosomal structures, and this subcellular distribution pattern of RAB24 may indicate its involvement in autophagy-related processes.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03629
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.7kDa (227aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 30% glycerol, 100mM NaCl, 1mM EDTA
Other Names Ras-related protein Rab-24.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap