RAB23, 1-234aa , Human, His tag E.coli

Categories: [Proteins / Peptides]
RAB23, also known as ras-related protein Rab23, is a member of the Rab family of proteins and localizes to the cytoplasmic side of the cell membrane. This protein is thought to to play a role in intracellular protein transportation and signal transduction mediated by small GTPases. RAB23 is an essential negative regulator of the Sonic hedgehog signaling pathway. Mutations in the gene encoding RAB23 may result in Carpenter syndrome a condition characterized by obesity, cardiac defects, polysyndactyly and craniosynostosis.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03628
Size 100 µg
Host E.coli
Accession
Molecular Weight 28.5 kDa (254aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 30% glycerol, 1mM DTT, 0.1mM PMSF
Other Names Ras-related protein Rab-23, DKFZp781H0695, HSPC137, MGC8900.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap