RAB21, 18-222aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Ras-related protein Rab-21, also known as RAB21, is a member of the Ras superfamily of small GTP-binding proteins. Rab21 is integrin-associated protein and positive regulators of integrin traffic. This protein associate with the cytoplasmic domains of alpha-integrin chains and their expression influences the endo/exocytic traffic of integrins.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03626
Size 50 µg
Host E.coli
Accession
Molecular Weight 27.1kDa (242aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol,2mM DTT, 200mM NaCl, 1mM PMSF
Other Names Ras-related protein Rab-21
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap