Home / Products / proteins / RAB18, 1-206 aa , Human, His tag E.coli

RAB18, 1-206 aa , Human, His tag E.coli

Categories: [Proteins / Peptides]
RAB18 is a member of a family of Ras-related small GTPase that is lipid-anchored to the cytoplasmic side of the cell membrane. It plays a role in apical recycling and endocytosis and is also thought to be involved in protein transport between early endosomes and the plasma membrane. Recombinant human Rab18 protein, fused to T7-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03623
Size 50 µg
Host E.coli
Accession
Molecular Weight 24.5 kDa (221aa)
AP_Mol_Weight
Tag N-6His
Sequences MASMTGGQQMGRGSHMDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 7.5) containing 1mM DTT.
Other Names Ras-related protein Rab-18, RAB18LI1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap