Home / Products / proteins / PTRH2, 64-179aa, Human, His tag, E.coli

PTRH2, 64-179aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PTRH2 (peptidyl-tRNA hydrolase 2), also known as BIT1, is a mitochondrial protein. During apoptosis, PTRH2 is released from the mitochondria to the cytoplasm. Once in the cytoplasm, PTRH2 regulates the function of two transcriptional regulators, TLE5 and TLE1, thereby promoting caspase-independent cell death. The natural substrate for PTRH2 may be petidyl-tRNAs which drop off the ribosome during protein synthesis.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03601
Size 100 μg
Host E.coli
Accession
Molecular Weight 14.9 kDa (137aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris buffer (pH 8.0) containing 10% glycerol, 1mM DTT
Other Names Peptidyl-tRNA hydrolase 2, BIT1, PTH2, CGI-147, Bcl-2 inhibitor of transcription 1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap