PTPN4, 655-913aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PTPN4 also known as Protein tyrosine phosphatase, non-receptor type 4, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPN4 is a widely expressed non-receptor protein tyrosine phosphatase. It has been shown to interact with glutamate receptor delta 2 and epsilon, and may affect glutamate receptors signaling and/or in regulation of their activities through tyrosine dephosphorylation. Recombinant human PTPN4, fused to His-tag at N-terminus, was expressed in E.coli
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03598
Size 100 µg
Host E.coli
Accession
Molecular Weight 32kDa (280aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMVLTQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYE
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris buffer (pH 8.0) containing 10% glycerol
Other Names Protein tyrosine phosphatase, non-receptor type 4, PTPMEG, PTPMEG1, MEG
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap