Home / Products / proteins / PTPMT1, 28-201 aa, Human, His tag E.coli

PTPMT1, 28-201 aa, Human, His tag E.coli

Categories: [Proteins / Peptides]
PTPMT1 (protein tyrosine phosphatase mitochondrial 1), also known as MOSP or PLIP (phosphoinositide lipid phosphatase) and previously known as DUSP23, is a widely expressed PTP membrane protein with high expression levels in pancreatic beta cells. This protein exclusively localizes to the matrix face of the inner membrane of the mitochondrion. It is responsible for dephosphorylating mitochondrial proteins and therefore plays a significant role in the production of ATP and secretion of insulin.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03597
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.6 kDa (199aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 1mM DTT, 0.15M NaCl.
Other Names Protein tyrosine phosphatase, mitochondrial 1, DUSP23, FLJ46081, MOSP, PLIP, PNAS-129.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap