Home / Products / proteins / PTP4A2, 1-167aa, Human, His tag, E.coli

PTP4A2, 1-167aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Protein tyrosine phosphatase type IVA 2 isoform 1, also known as PTP4A2, belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTP4A2 is localized to the early endosome that play regulatory roles in a variety of cellular processes. This protein was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03596
Size 50 µg
Host E.coli
Accession
Molecular Weight 23.2 kDa (203aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT,10% glycerol
Other Names Protein tyrosine phosphatase type IVA 2 isoform 1, HH13, HH7-2, HU-PP-1, OV-1, PRL-2, PRL2, ptp-IV1a, ptp-IV1b, PTP4A, PTPCAAX2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap