PTP4A1, 1-170aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PTP4A1, also known as protein tyrosine phosphatase type IVA 1, is cell signaling molecule that plays regulatory roles in a variety of cellular processes. This protein is a unique nuclear PTP that is induced in regenerating liver and mitogen stimulated cells. It is primarily expressed in spleen, bone marrow, thymus, lymph nodes, T lymphocytes and tonsil and is overexpressed in tumor cell lines.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03595
Size 100 μg
Host E.coli
Accession
Molecular Weight 21.6 kDa (190aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNC
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT
Other Names Protein tyrosine phosphatase type IVA 1, HH72; PRL-1; PRL1, PTP(CAAX1), PTPCAAX17C1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap