Home / Products / proteins / PTP-1B(Protein Tyrosine Phosphatase1B), Human, Recombinant, E.coli

PTP-1B(Protein Tyrosine Phosphatase1B), Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
The protein coding region of the catalytic domain of PTP-1B (amino acids 1-321) was cloned into an E. coli expression vector. The catalytic domain of PTP-1B was overexpressed in E. coli as a soluble protein, and it was purified by conventional column chromatographic techniques.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03594
Size 100 µg
Host E.coli
Accession
Molecular Weight 37.3 kDa (321 aa)
AP_Mol_Weight
Tag
Sequences MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 25 mM Tris-HCl buffer (pH 7.5) containing 1 mM DTT, 2 mM β-mercaptoethanol, 1 mM EDTA, 20%Glycerol
Other Names Protein tyrosine phosphatase, non-receptor type 1, PTPN1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap