Home / Products / proteins / PTGR1, 1-329aa , Human, His tag, E.coli,

PTGR1, 1-329aa , Human, His tag, E.coli,

Categories: [Proteins / Peptides]
PTGR1, also known as LTB4DH, belongs to the NADP-dependent oxidoreductase L4BD family. This enzyme catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4. It is highly expressed in the kidney, liver, and intestine but not in leukocytes.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03589
Size 100 µg
Host E.coli
Accession
Molecular Weight 38.6kDa (354aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSEFMVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA
Purity > 95% by HPLC
Concentration 0.5mg/ml
Formulation Liquid. In 20 mM Tris-HCl buffer, pH7.5, 10% glycerol, 1mM DTT, 200mM NaCl
Other Names prostaglandin reductase 1, LTB4DH, PGR1, ZADH3.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap