Home / Products / proteins / PSMB4, 46-264aa, Human, His tag, E.coli

PSMB4, 46-264aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Proteasome subunit beta type-4, also known as PSMB4, belonged to the peptidase T1B family. The 20S Proteasome chamber contains alpha subunits (which are structural) and beta subunits (which are predominantly catalytic). The outer two rings in the proteasome consist of seven alpha subunits each and the inner two rings each consist of seven beta subunits. PSMB4 is a beta subunit of the 20S Proteasome.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03571
Size 50 µg
Host E.coli
Accession
Molecular Weight 26.6 kDa (240aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 30% glycerol, 0.1M NaCl
Other Names Proteasome subunit beta type-4, HN3, HsN3, PROS-26, PROS26.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap