Home / Products / proteins / PSMA1, 1-263 aa, Human, His tag, E.coli

PSMA1, 1-263 aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PSMA1 is a prosomal protein involved in a nonlysosomal ATP/ubiquitin-dependent proteolytic pathway. The protein is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. This protein highly expressed in prostate epithelium. Recombinant human PSMA1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03559
Size 100 µg
Host E.coli
Accession
Molecular Weight 32 kDa (286aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 2mM DTT, 0.15M NaCl.
Other Names Proteasome subunit alpha type-1 isoform 2, HC2, NU, PROS30.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap