Home / Products / proteins / PS mg3, 1-122aa, Human, His tag, E.coli

PS mg3, 1-122aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PSMG3 is a chaperone protein which promotes assembly of the 20S proteasome. This protein may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes. It interacts with PSMG4, as well as directly alpha and beta subunits of the 20S proteasome but dissociates before the formation of half-proteasomes, probably upon recruitment of POMP.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03554
Size 10 µg
Host E.coli
Accession
Molecular Weight 15.2 kDa(142aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol
Other Names Proteasome assembly chaperone 3, PAC3, C7orf48
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap