Home / Products / proteins / Prss28, 27-274aa, Mouse, His-tag, Baculovirus

Prss28, 27-274aa, Mouse, His-tag, Baculovirus

Categories: [Proteins / Peptides]
Prss28, also known as serine protease 28, belongs to the S1 serine proteinase family with a conserved Histidine-Aspartic Acid-Serine catalytic triad. It exhibits mixed substrate specificity that silences signaling via proteinase-activated receptors. It is involved with embryo hatching and its activity is important for successful implantation. Recombinant mouse Prss28, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03550
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 28.7kDa (256aa), 28-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences KPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGIDCSNNLPSIFSRVQSSLAWIHQHIQLEHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol
Other Names Serine protease 28, Prss28, Isp1, mIsp-1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap