Prss22, 33-307aa, Mouse, His tag, Baculovirus

Categories: [Proteins / Peptides]
Prss22, also known as brain-specific serine protease 4, is identified brain-specific expression gene. Brain-specific serine protease 4(BSSP-4) and brain serine protease 2 (BSP-2) are different names given for the same serine protease that is encoded by the Prss22 gene. This protein is preferentially expressed in epithelium-rich tissues such as the lung and eye. Recombinant mouse Prss22, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03549
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 31.1kDa (283aa), 28-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences ATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCAERNRPGVYTSLLAHRSWVQRIVQGVQLRGYLADSGDTGSSLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol
Other Names Brain-specific serine protease 4, Prss22, 4733401N09Rik, BSSP-4, SP001LA, Brain specific serine protease 4, BSSP 4, BSSP4, hBSSP 4, MGC9599.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap