Home / Products / proteins / PRPS2,1-321aa, Human, His tag, E.coli

PRPS2,1-321aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PRPS2 also known as ribose-phosphate pyrophosphokinase 2 isoform 1. The Protein belongs to the ribose-phosphate pyrophosphokinase family. The Protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants. Recombinant human PRPS2, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03545
Size 100 µg
Host E.coli
Accession
Molecular Weight 37.4kDa (344aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm )
Formulation Liquid. In Phosphate buffered saline (pH7.4) containing 10% glycerol, 1mM DTT
Other Names Ribose-phosphate pyrophosphokinase 2 isoform 1 , PRSII
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap