Home / Products / proteins / PRPS1, 1-318aa, Human, His tag, E.coli

PRPS1, 1-318aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PRPS1, also known as ribose-phosphate pyrophosphokinase 1, is ubiquitously expressed in human tissues. This enzyme catalyzes the phosphoribosylation of ribose 5-phosphate to 5-phosphoribosyl-1- pyrophosphate, which is necessary for purine metabolism and nucleotide biosynthesis. Recombinant human PRPS1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03544
Size 100 µg
Host E.coli
Accession
Molecular Weight 36.9 kDa (338aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 0.1 M NaCl, and 20% glycerol
Other Names Ribose-phosphate pyrophosphokinase 1, ARTS, CMTX5, PPRibP, PRSI, DFN2, DFNX1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap