Protein S100-A10, 1-97aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
S100A10 also known as S100 calcium binding protein A10 is a group of small Ca2+ binding proteins with molecular weight of 10-12 kDa. Intracellular S100 proteins usually function as modulators of their target proteins, and exert various roles such as regulation of protein phosphorylation, enzyme activity, Ca2+ homeostasis, cytoskeleton components, and transcription factors. Recent research suggests a role for S100A10 as a prognostic marker and potential therapeutic target in colorectal cancer. Recombinant mouse S100A10, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03543
Size 20 µg
Host E.coli
Accession
Molecular Weight 13.6 kDa (120aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate buffered saline (pH 7.4) containing 10% glycerol.
Other Names 42C, AA409961, AL024248, CAL12; Cal1l, CLP11, p10, p11, S100a10
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap