Protein delta homolog 1, 24-303aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
DLK1, also known as protein delta homolog 1, belongs to the Notch/Delta/Serrate family of epidermal growth factor (EGF)-like repeat-containing proteins that act as ligands in the Notch signaling pathway. It has six well conserved epidermal-growth-factor motifs and contains up to ten O-glycosylation and N-glycosylation sites, six of which are differentially glycosylated. Recombinant human DLK1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03540
Size 50 µg
Host Insect cell
Accession
Molecular Weight 30.7kDa (288aa) 28-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQLEHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Delta1, DLK, DLK-1, FA1, pG2, Pref-1, PREF1, ZOG, DLK1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap