Prostagladin E synthase 3, 1-160 aa, Human, E.coli

Categories: [Proteins / Peptides]
Prostaglandin E synthase 3 (PTGES3), also known as P23 or TEBP (Telomerase binding protein p23), is a ubiquitously expressed protein that functions as a cochaperone and plays an important role in signal transduction. This protein is a molecular chaperone that localizes to genomic response elements in a hormonedependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03538
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.6 kDa (160aa)
AP_Mol_Weight
Tag
Sequences MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Purity > 95% by HPLC
Concentration 0.5 mg/mL
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT 10% glycerol
Other Names PTGES3, cPGES, P23, TEBP, HSP90 co-chaperone
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap