Profilin 1, 1-140 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Profilin1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. This protein significantly enhances skin wound healing in-vitro and in-vivo that may be mediated by purinergic receptors. It is also active in endothelial cell migration and vessel sprouting. It is thought to regulate actin polymerization in response to extracellular signals.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03534
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.0 kDa (140aa)
AP_Mol_Weight
Tag
Sequences MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol
Other Names PFN1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap