Home / Products / proteins / PRND, 27-152aa Human, His tag, E.coli

PRND, 27-152aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
PRND is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. This protein is expressed during embryogenesis, but is expressed minimally in the central nervous system. Its function is still unknown. Mutations in PRND may lead to neurological disorders. Recombinant human PRND protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03531
Size 20 µg
Host E.coli
Accession
Molecular Weight 16.9 kDa (149aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 7.5) containing 0.2M NaCl, 30% glycerol, 1mM DTT
Other Names Prion-like protein doppel, Prion protein 2, DOPPEL, DPL, PrPLP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap