PRL-3, 1-173 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Protein tyrosine phosphatase type IVA 3 (PRL-3), as known as PTP4A3, belongs to a small class of prenylated protein tyrosine phosphatases (PTPs) that remove phosphate modifications from tyrosine residues on proteins. This protein enhances cell proliferation, cell motility and invasive activity. High levels of PRL-3 expression are associated with tumorigenesis and metastasis, thus it is overexpressed in metastatic colorectal, ovarian, liver and skin cancers.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03527
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.6 kDa (193aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 2 mM EDTA,1 mM DTT, 10% glycerol
Other Names Protein tyrosine phosphatase type IVA 3, PTP4A3, PRL3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap