PRKACA, 1-351aa, Human, GST-tag, Baculovirus

Categories: [Proteins / Peptides]
PRKACA, also known as cAMP-dependent protein kinase catalytic subunit alpha isoform Calpha1, is a member of the Ser/Thr protein kinase family. It is responsible for phosphorylating other proteins and substrates, changing their activity. This protein is a member of the AGC kinase family, and contributes to the control of cellular processes that include glucose metabolism, cell division, and contextual memory. Recombinant human PRKACA protein, fused to GST-tag at N-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $276
  • Buy 5 for $262.2 each and save 5%
  • Buy 21 for $248.4 each and save 10%
  • Buy 31 for $234.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03522
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 67.0kDa (578aa), 50-70KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names cAMP-dependent protein kinase catalytic subunit alpha isoform Calpha1, PRKACA, PKACA, PPNAD4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap